A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10627
Swiss-prot Accession number	P25329 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain (Anterior pituitary glycoproteinhormones common subunit alpha) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain)(Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropin alphachain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Physeter catodon (Sperm whale) (Physeter macrocephalus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Odontoceti; Physeteridae; Physeter.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	96 Amino acids
Molecular weight	10718
References	1  PubMed abstract 3771098
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPNGZFTMQGCPZCKLKQNKYFSKLGAPIYZCMGCCFSRAYPTPARSKKTMLVPKNITSZATCCVAKAFTKATVMGNARVQNHTZCHCSTCYYHKS
Position of mature hormone in Pre-Hormone protein	96 Residues from position (1-96)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10642
Swiss-prot Accession number	P25330 (Sequence in FASTA format)
Description	Lutropin subunit beta (Luteinizing hormone subunit beta) (LSH-beta)(LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Physeter catodon (Sperm whale) (Physeter macrocephalus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Odontoceti; Physeteridae; Physeter.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	118 Amino acids
Molecular weight	12412
References	1  PubMed abstract 3771098 2  PubMed abstract 6466737
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	PRGPLRPLCRPINATLAAQNZACPVCITFTTSICAGYCPSMVRVLPAALPPVPZPVCTYRQLRFASIRLPGCPPGVNPMVSFPVALSCHCGPCRLSSSDCGPGRAQPLACNRSPRPGL
Position of mature hormone in Pre-Hormone protein	118 Residues from position (1-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10877
Swiss-prot Accession number	P67974 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Physeter catodon (Sperm whale) (Physeter macrocephalus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Odontoceti; Physeteridae; Physeter.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5766
References	1  PubMed abstract 13373434 2  PubMed abstract 13552701
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10878
Swiss-prot Accession number	P67974 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Physeter catodon (Sperm whale) (Physeter macrocephalus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Odontoceti; Physeteridae; Physeter.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5766
References	1  PubMed abstract 13373434 2  PubMed abstract 13552701
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated